CDS

Accession Number TCMCG039C11476
gbkey CDS
Protein Id XP_024022346.1
Location join(<639..774,886..1041,1361..1444)
Gene LOC112091873
GeneID 112091873
Organism Morus notabilis

Protein

Length 124aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA263939
db_source XM_024166578.1
Definition coatomer subunit epsilon-1-like, partial [Morus notabilis]

EGGNOG-MAPPER Annotation

COG_category U
Description The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non- clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. The coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko04131        [VIEW IN KEGG]
ko04147        [VIEW IN KEGG]
KEGG_ko ko:K17268        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005773        [VIEW IN EMBL-EBI]
GO:0005774        [VIEW IN EMBL-EBI]
GO:0005794        [VIEW IN EMBL-EBI]
GO:0005798        [VIEW IN EMBL-EBI]
GO:0005829        [VIEW IN EMBL-EBI]
GO:0006810        [VIEW IN EMBL-EBI]
GO:0006888        [VIEW IN EMBL-EBI]
GO:0006890        [VIEW IN EMBL-EBI]
GO:0006891        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0012506        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016192        [VIEW IN EMBL-EBI]
GO:0030117        [VIEW IN EMBL-EBI]
GO:0030120        [VIEW IN EMBL-EBI]
GO:0030126        [VIEW IN EMBL-EBI]
GO:0030135        [VIEW IN EMBL-EBI]
GO:0030137        [VIEW IN EMBL-EBI]
GO:0030659        [VIEW IN EMBL-EBI]
GO:0030660        [VIEW IN EMBL-EBI]
GO:0030662        [VIEW IN EMBL-EBI]
GO:0030663        [VIEW IN EMBL-EBI]
GO:0031090        [VIEW IN EMBL-EBI]
GO:0031410        [VIEW IN EMBL-EBI]
GO:0031982        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044431        [VIEW IN EMBL-EBI]
GO:0044433        [VIEW IN EMBL-EBI]
GO:0044437        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046907        [VIEW IN EMBL-EBI]
GO:0048193        [VIEW IN EMBL-EBI]
GO:0048475        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051234        [VIEW IN EMBL-EBI]
GO:0051641        [VIEW IN EMBL-EBI]
GO:0051649        [VIEW IN EMBL-EBI]
GO:0097708        [VIEW IN EMBL-EBI]
GO:0098588        [VIEW IN EMBL-EBI]
GO:0098796        [VIEW IN EMBL-EBI]
GO:0098805        [VIEW IN EMBL-EBI]

Sequence

CDS:  
AATGCGCTAAACGTCCAGATATTCCTCAAGATGCATAGGTCCGATTATGCAGAGAGACAGTTGAGAGTAATGCAGCAGGTGGATGAGGATCACACACTAACTCAACTCACAAGTGCATGGTTCAATCTGGCAGTGGGTGGATCCAAGATACAGGAAGCATATCTTATCTTCCAAGATTTCTCTGAGAAATATCAGATGACCAGTTTGGTACTGAACGGGAAGGCTGTTTGCTGCATGCATATGGGAAACTTTGATGAAGCTGAAACACTGCTGCTTGAAGCACTCAACAAGGACGCAAAGGATCCAGAAACTCTAGCCAATCTAGTTGTAAGCTGTCTTCACCTTGGCAAACCGCCCTCCCGTTTCCTCAGGTAA
Protein:  
NALNVQIFLKMHRSDYAERQLRVMQQVDEDHTLTQLTSAWFNLAVGGSKIQEAYLIFQDFSEKYQMTSLVLNGKAVCCMHMGNFDEAETLLLEALNKDAKDPETLANLVVSCLHLGKPPSRFLR